PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G105600.1
Common NamePHAVU_011G105600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 74aa    MW: 8275.13 Da    PI: 4.2703
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G105600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.32.1e-092666345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                         +++ E+ l++ + ++ G + W++Ia +++ gRt++++  +w 
  Phvul.011G105600.1 26 EFSEAEEILIAMVYNLVGER-WSLIAGRIP-GRTAEEIEKYWT 66
                        58999999999999999999.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.98E-82369IPR009057Homeodomain-like
SMARTSM007175.0E-62371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-122667IPR009057Homeodomain-like
PfamPF002499.3E-92666IPR001005SANT/Myb domain
CDDcd001673.24E-62665No hitNo description
PROSITE profilePS500906.2952769IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MADIDRSSDN SSADSKEKTL QISNVEFSEA EEILIAMVYN LVGERWSLIA GRIPGRTAEE  60
IEKYWTSRYS TSQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2381135e-94KP238113.1 Lablab purpureus caprice and triptychon-like enhancer transcript variant X2 (etcl2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132566.11e-46hypothetical protein PHAVU_011G105600g
SwissprotO220593e-16CPC_ARATH; Transcription factor CPC
TrEMBLV7AH201e-46V7AH20_PHAVU; Uncharacterized protein
STRINGGLYMA12G10790.17e-40(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.12e-17MYB_related family protein